<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SB-PtC SB-PtC-w48 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NFV NA
2 NRTI+LPV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, L90M L33F, N88G L10I, I13V, G16A, Q18H, N37D, Q61H, L63P, A71L, I72T, V77I, I93L  
>SB-PtC-w48| codons 1-99
PQITLWQRPIVTVKIAGHLKEALLDTGADDTVFEEMDLPGRWKPKIIGGIGGFVKVRQYD
HIPIEICGHKLTGTVVIGPTPVNIIGRGLMTQLGCTLNF

References
Author Title Citation
Brun, S Patterns of protease inhibitor cross resistance in viral isolates with reduced susceptibility to lopinavir. CROI 2001, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005