<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI+IDV NA
2 NRTI+LPV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10X, E35D, M36I, L63P, I64V  
>SB-PtA-w12| codons 1-99
PQITLWQRPXVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Brun, S Patterns of protease inhibitor cross resistance in viral isolates with reduced susceptibility to lopinavir. CROI 2001, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005