<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SB-PtA SB-PtA-w12 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+IDV NA
2 NRTI+LPV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10X, E35D, M36I, L63P, I64V  
>SB-PtA-w12| codons 1-99
PQITLWQRPXVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Brun, S Patterns of protease inhibitor cross resistance in viral isolates with reduced susceptibility to lopinavir. CROI 2001, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005