<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SB-PtD SB-PtD-BL U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, E35D, L63A, A71V, I85V, I93L  
>SB-PtD-BL| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFVKVRQYD
QIAIEICGHKVIGTVLVGPTPANIVGRNLLTQLGCTLNF

References
Author Title Citation
Brun, S Patterns of protease inhibitor cross resistance in viral isolates with reduced susceptibility to lopinavir. CROI 2001, 2001
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005