Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SW31896 | SW31896 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | NRTI+ APV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, I47V | L10I, T12A, I13V, G16E, P39S, R57K, I64V, A71T, I72V, I93L |
| >SW31896| codons 1-99 PQITLWQRPIVAVKIEGQLKEALLDTGADDTILEEMNLSGRWKPKMVGGIGGFIKVKQYD QILVEICGHKTVGTVLVGPTPVNIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Maguire, M | Emergence of resistance to protease inhibitor amprenavir in human immunodeficiency virus type 1-infected patients: selection of four alternative viral protease genotypes and influence of viral susceptibility to coadministered reverse transcriptase nucleoside inhibitors. | AAC, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
