Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
SW32390 | SW32390 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
Order | Regimen | Weeks |
1 | NRTI | NA |
2 | NRTI+ APV | 48 |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
I84V | T12P, I13V, K14R, E35D, N37E, K55R, L63P |
>SW32390| codons 1-99 PQITLWQRPLVPVRIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIRVRQYD QIPIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF |
References
Author | Title | Citation |
Maguire, M | Emergence of resistance to protease inhibitor amprenavir in human immunodeficiency virus type 1-infected patients: Selection of four alternative viral protease genotypes and influence of viral susceptibility to coadministered reverse transcriptase nucleoside inhibitors. | AAC, 2002 |
Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
Rhee, SY | Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. | AAC, 2004 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |