Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SW32390 | SW32390 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | NRTI+ APV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I84V | T12P, I13V, K14R, E35D, N37E, K55R, L63P |
| >SW32390| codons 1-99 PQITLWQRPLVPVRIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIRVRQYD QIPIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Maguire, M | Emergence of resistance to protease inhibitor amprenavir in human immunodeficiency virus type 1-infected patients: Selection of four alternative viral protease genotypes and influence of viral susceptibility to coadministered reverse transcriptase nucleoside inhibitors. | AAC, 2002 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. | AAC, 2004 |
| Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |