<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW32381 SW32381 U.S. 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 NRTI+ APV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L   L10I, I13V, K20R, M36I, N37D, R41K, L63V, H69K  
>SW32381| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEEIDLPGKWKPKLIGGIGGFLKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Maguire, M Emergence of resistance to protease inhibitor amprenavir in human immunodeficiency virus type 1-infected patients: selection of four alternative viral protease genotypes and influence of viral susceptibility to coadministered reverse transcriptase nucleoside inhibitors. AAC, 2002
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005