Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SW32381 | SW32381 | U.S. | 1998 | HIV1 | A | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | NRTI+ APV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54L | L10I, I13V, K20R, M36I, N37D, R41K, L63V, H69K |
| >SW32381| codons 1-99 PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEEIDLPGKWKPKLIGGIGGFLKVRQYD QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Maguire, M | Emergence of resistance to protease inhibitor amprenavir in human immunodeficiency virus type 1-infected patients: selection of four alternative viral protease genotypes and influence of viral susceptibility to coadministered reverse transcriptase nucleoside inhibitors. | AAC, 2002 |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |