<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NK-18 NK-18 Burundi 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F L10I, I13V, K14R, K20R, M36I, R41K, R57K, L63V, H69Q, K70R, L89M  
>NK-18| codons 1-99
PQITLWQRPIVTVRIGGQLREALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVKQYD
QIVIEICGQRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, V60I, K122E, D123S, S134N, I135T, E138A, I142V, K173A, Q174K, V179I, I202V, Q207S, R211S, F214L  
>NK-18| codons 30-237
KIKALTDICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPNTNNATPGVRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRAKNPDIIIYQYMDDLYVGSDLEIGQHRTKVEELRSHL
LSWGLTTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Koch, N Genetic analysis of HIV type 1 strains in Bujumbura (Burundi): Predominance of subtype C variant. ARHR, 2001