<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, K43R, I62V, L63P, H69Q, K70Q, A71T, I93L  
>CUPL1080| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGQQTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35S, E53D, V60I, K122E, D123S, S162A, E169D, D177E, I178L, Q207E, D250E, A272P, K277R, T286A, E297A, K311R, S322A, I329V, G335D, R356K, E370D, A376S, T377L, T386I, K390R K46N, R199S
>CUPL1080| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALSEICTEMEKEGNISKIGPDNPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIGQHSTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTAEAE
LELAENREILREPVHGVYYDPAKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTDAVQKISLESIVIWGKIPKFRLPIQKETWEA

References
Author Title Citation
Machado, LY HIV type 1 genetic diversity in newly diagnosed Cuban patients. ARHR, 2012
Machado, LY Transmitted HIV yype 1 drug resistance in newly diagnosed Cuban patients. ARHR, 2012