<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NK-15 NK-15 Burundi 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TP, K14R, I15V, G16AE, M36I, N37K, R41N, H69K, V82I, L89M, I93L  
>NK-15| codons 1-99
PQITLWQRPLVPIRVAGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, E40D, K49R, K122E, D123S, I159V, K173A, T200A, Q207E  
>NK-15| codons 30-237
KIKALTAICEDMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAVFQSSMTKILEPFRAQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHL
LRWGFTTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Koch, N Genetic analysis of HIV type 1 strains in Bujumbura (Burundi): Predominance of subtype C variant. ARHR, 2001