<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10I, I13V, K20I, M36I, N37S, R41K, I64M, H69K, V82I, L89M, I93L  
>CUPL1027| codons 1-99
PQITLWQRPIITVKIGGQLIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E V21I, V35T, T39K, E40D, M41I, E42K, K43R, E44K, G45E, I50M, V60I, K103R, I135V, K173I, D177E, T200A, Q207K, R211S  
>CUPL1027| codons 1-235
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICKDIKRKEKISKMGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIQNPEIEI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELH

References
Author Title Citation
Machado, LY HIV type 1 genetic diversity in newly diagnosed Cuban patients. ARHR, 2012
Machado, LY Transmitted HIV yype 1 drug resistance in newly diagnosed Cuban patients. ARHR, 2012