<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NK-7 NK-7 Burundi 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, G16E, L19I, M36I, R41K, D60E, I62V, L63S, I64M, H69K, K70R, L89M, I93L  
>NK-7| codons 1-99
PQITLWQRPLVSIKIEGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QVSMEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, I47L, K49KR, D121H, K122E, D123S, S162C, K173I, Q174K, D177E, T200A, Q207E, R211K  
>NK-7| codons 30-237
KIKALTAICEEMEKEGKLSRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQCSMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHL
LKWGFTTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Koch, N Genetic analysis of HIV type 1 strains in Bujumbura (Burundi): Predominance of subtype C variant. ARHR, 2001