<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CUPL0910 CUPL0910 Cuba 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, K43R, I62V, L63P, H69Q, I72V  
>CUPL0910| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGQKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      G190K V35K, G45E, I50M, V60I, W88G, S117P, D121N, D123E, R125K, S162C, E169D, D177E, E194K, T200A, E204K, D237N, Q242R D17V, I37N, R72K, D186N, W229G
>CUPL0910| codons 1-244
PISPIETVPVKLKPGMVGPKVKQWPLTEEKIKALKENCTEMEKEEKISKMGPENPYNTPI
FAIKKKDSTKWKKLVDFRELNKRTQDFGEVQLGIPHPAGLKKKKSVTVLDVGDAYFPVPL
NKEFKKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDNLYVKSDLKIGQHRAKIEKLRQHLLRWGFTTPDKKHQKEPPFLGMGYELHPNKWT
VRPI

References
Author Title Citation
Machado, LY HIV type 1 genetic diversity in newly diagnosed Cuban patients. ARHR, 2012
Machado, LY Transmitted HIV yype 1 drug resistance in newly diagnosed Cuban patients. ARHR, 2012