<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI+RTI 52
2 PI+RAL+RTI 30

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H V151I D6E, E10D, A23S, V31I, L101I, T124A, K156N, V201I, D232N, M275V  
>41205A.8| codons 1-288
FLDGIEKAQDEHEKYHSNWRAMSSDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVIESMHNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQVAGDDCVASRQDED

References
Author Title Citation
Lee, GQ Prolonged and substantial discordance in prevalence of raltegravir-resistant HIV-1 in plasma versus pbmc samples revealed by 454 PLoS ONE, 2012