<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90I, I142M, S162H, K173Q, Q207D, R211K, V245Q  
>1654.RT| codons 2-250
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGMRYQYNVLPQGWKGSPAIFQHSMTKILEPFRQQNPDIVIY
QYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIQLPEKD

References
Author Title Citation
El Annaz, H Drug resistance mutations in HIV type 1 isolates from patients failing antiretroviral therapy in Morocco. ARHR, 2012