<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V179D T27S, A98S, K122E, I135T, I142IV, Q145QH, S162C, T200A F116G
>7107.RT| codons 11-204
KLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTK
WRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYGSVPLDEDFRKYTAF
TIPSTNNETPGVRYHYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIDIYQYVDDLYVG
SDLEIGQHRAKIEE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L10F, L33I I13V, I15L, E35D, M36I, N37T, R41K, R57K, I62IV, L63A, I64V, E65D, I93L  
>7107.PR| codons 1-99
PQITLWQRPFVTVKLGGQLKEALLDTGADDTVIEDITLPGKWKPKIIGGIGGFIKVKQYD
QVAVDICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
El Annaz, H Drug resistance mutations in HIV type 1 isolates from patients failing antiretroviral therapy in Morocco. ARHR, 2012