<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|IDV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V     V35I, T39N, D123E, I142V, K173A, Q174K, D177E, T200A, Q207A, R211K, L228LR, K249Q  
>5944.RT| codons 2-255
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICNEMEKEGKISKIGPENPYNTPVF
VIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVIY
QYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWTV
QPIVLPEQDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L89V I13V, L19I, K20I, E35D, M36I, N37E, L63LP, I64M, H69K, A71V, I72IV  
>5944.PR| codons 1-99
PQITLWQRPLVTVKIGGQIIEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYD
QIPMEICGKKVVGTVLVGPTPANIIGRNVLTQIGCTLNF

References
Author Title Citation
El Annaz, H Drug resistance mutations in HIV type 1 isolates from patients failing antiretroviral therapy in Morocco. ARHR, 2012