<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1011 1011.PR Morocco 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|IDV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13IV, I15IV, K20M, E35D, M36I, R41K, K43KR, I62V, L63AS, I64V, E65D  
>1011.PR| codons 1-99
PQITLWQRPLVAVKVGGQLMEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QVSVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       I135T, S162SC, Q207E, R211K  
>1011.RT| codons 27-234
TEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQD
FWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQY
NVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELR
EHLLKWGFTTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
El Annaz, H Drug resistance mutations in HIV type 1 isolates from patients failing antiretroviral therapy in Morocco. ARHR, 2012