<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P68 P68-2 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37H, I62V, L63P, V77I, I93L  
>P68-2| A02 | codons 1-99 | clone A02
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P68-2| A08 | codons 1-99 | clone A08
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
KVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P68-2| A07 | codons 1-99 | clone A07
PQITPWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P68-2| A04 | codons 1-99 | clone A04
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P68-2| A01 | codons 1-99 | clone A01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEANLPGRWKPKMIGGIGGFIRVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P68-2| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, R83K, D123E, I135T, I178L  
>P68-2| A02 | codons 1-229 | clone A02
PISPIETVPVKLKPGMDGPKVKQWPLTEGKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYAAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P68-2| A08 | codons 1-229 | clone A08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMKKEGKISKIGPENPYNTPV
FAIKKKDSTKWKKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P68-2| A07 | codons 1-229 | clone A07
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P68-2| A04 | codons 1-229 | clone A04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYLSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKGPPFLW
>P68-2| A01 | codons 1-229 | clone A01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPCNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P68-2| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005