<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NP-D16 NP-D16 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 IDV NA
3 NVP+ABC+NFV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F   L10I, L63T, V77I  
>NP-D16| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAIGTVLIGPTPFNIIGRNLLTQIGCTLNF

References
Author Title Citation
Parkin, NT Discordance between genotype-based predictions of protease inhibitor susceptibility and actual phenotype in HIV-1 isolates containing mutations at positions 82 and 90: Modulatory effects of mutations at secondary positions. ICAAC 2000, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005