<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA
2 IDV NA
3 NVP+ABC+NFV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F   L10I, L63T, V77I  
>NP-D16| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAIGTVLIGPTPFNIIGRNLLTQIGCTLNF

References
Author Title Citation
Parkin, NT Discordance between genotype-based predictions of protease inhibitor susceptibility and actual phenotype in HIV-1 isolates containing mutations at positions 82 and 90: Modulatory effects of mutations at secondary positions. ICAAC 2000, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005