<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12P, N37S, R41K, G51GE, L63V, G68GE, L89M, I93L W42W*, R87RK
>PRRT_4178| codons 1-99
PQITLWQRPVVPIKIGGQLKEALLDTGADDTVLEEMSLPGK*KPKMIGGIEGFIKVRQYD
QIVIEICEHKAIGTVLVGPTPVNIIGKNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6EK, V60I, K102KR, D123E, I135T, I180V, D192DN, Q207A, R211K, V245K, A272P, K277R, I293V, E297T, E305EK, S322T, Q334H, F346Y, M357IT, E404D, E449ED, S468P, L517V, Q547K, A554S G262GE
>PRRT_4178| codons 1-560
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
YQYMDDLYVGSNLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVEKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTTEAE
LELAKNREILKEPVHGVYYDPTKDLIAEIQKQGHGQWTYQIYQEPYKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRDTKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESEVVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEKVDKLVSSGIRKVL

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009