<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PRRT_4099 PRRT_4099 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V106I, D123DN, I135T, S162C, I178ILM, E204D, R211K, K277R, A288S, I293V, E297A, G333D, A376T, T386I, K390R, E399D, A400T, E432ED, K454R, K558R  
>PRRT_4099| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEDLRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQDQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKIPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGRAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, D60E, L63C  
>PRRT_4099| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYE
QICIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009