<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP-34 AP-34 Greece 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 52
2 D4T+ DDI+ NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y K219R Y188L   K43N, E44D, V118I, K122E, I135T, G196E, Q197K, K223Q, L228R T84S
>AP-34| codons 41-244
LENDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRSQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIEKHRTKIEELRQHLWRWGFYTPDRK
HQQEPPFRWMGYELHPDKWTVQPI

References
Author Title Citation
Papa, A HIV-1 subtypes and circulating recombinant forms (CRFs) in Northern Greece. Virus Res, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005