<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03GEMZ037 03GEMZ037 Republic Of Georgia 1999 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3E, R20K, V31I, I72V, L74I, T112V, I113V, S119P, T124S, T125A, G134D, K136Q, D167E, V201I, T218I, L234I, S255N  
>03GEMZ037| codons 1-288
FLEGIDKAQEEHEKYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSSAVKAACWWADIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, N37D, R41K, Q61E, H69K, L89M  
>03GEMZ037| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, E36D, T39N, E40D, K104R, K122E, D123S, I135T, S162C, K173S, Q174K, D177E, Q207A, L210M, R211S, V245M, P247L, E248D, A272P, T286A, E291D, V292I, I293V, P294T, K311R, I326V, R356K, M357K, R358G, G359S, E370A, A371V, I375V, K390R, T403M, L452I, S468P, D471E, Q480H, L491S, I506V, K512R, L517I, S519N, Q520K, Q524K, K527E, K530R, A534S, A554N, K558R  
>03GEMZ037| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTDICNDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLMSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLLDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILREPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKGSA
HTNDVKQLTAVVQKVATESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQKVVPLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIVQAQPDRSESEIVNKIIEKLIEKERVYLSWVPAHK
GIGGNEQVDKLVSNGIRRVL

References
Author Title Citation
Zarandia, M HIV-1 genetic diversity and genotypic drug susceptibility in the Republic of Georgia. ARHR, 2006