<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14E, I15V, G16E, L19T, M36I, R41K, K45R, D60E, Q61K, L63T, H69K, L89I, I93L  
>SO_7| codons 1-99
PQITLWQRPLVTIEVEGQTKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYE
KITIEICGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39E, S48T, V118I, K122E, K126R, I135T, I142V, S162N, T165I, K166R, K173T, Q174K, V179I, T200A, I202V, Q207E, R211K, F214L, V245Q, E248N, D250E, A272P, Q278Y, K281R, T286A, E291D, V292I, I293V  
>SO_7| codons 1-315
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRRYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQNSMIRILEPFRTKNPDIII
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKYLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVH

References
Author Title Citation
Gonzalez, S Short communication: Antiretroviral therapy resistance mutations present in the HIV type 1 subtype C pol and env regions from therapy-naive patients in Zambia. ARHR, 2010