<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP-11 AP-11 Greece 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDC+ AZT+ 3TC 52
2 DDI+ D4T+ NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M, K219N Y181C   K43Q, E44D, V60I, K82R, R83K, A98S, V118I, I135T, A158T, S162D, G196E, E203K, H208Y, R211K, K223Q  
>AP-11| codons 41-244
LEQDGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNRKTQDFWEVQLGIPHPSGL
KKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPTIF
QDSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYTPDNK
HQQEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Papa, A HIV-1 subtypes and circulating recombinant forms (CRFs) in Northern Greece. Virus Res, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005