<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        G18X, V35T, T39L, V60I, V118I, T139S, K173A, Q174K, Q207E, R211K, F214L  
>MAM18TR| codons 14-239
PGMDXPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIP
SINNESPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIVIYQYMDDLYVGSDL
EIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82L, L90M   T4I, I15V, K20T, E35N, M36I, R41K, K45R, R57K, Q61E, I62V, L63P, I64L, V77I, L89I, I93L  
>MAM18PT| codons 1-99
PQIILWQRPLVTIKVGGQLTEALLDTGADDTVLENINLPGKWKPRMIGGIGGFIKVKQYD
EVPLEICGHKAIGTVLIGPTPLNIIGRNIMTQLGCTLNF

References
Author Title Citation
Gaspareto, KV Genetic diversity and primary resistance among HIV-1-positive patients from Maringa, Parana, Brazil. Rev Inst Med Trop Sao Paulo, 2012