<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E53D, K82R, I135L, I142T, S162C, K173T, Q174K, V189I, T200I, I202V, Q207D, L210M, R211K  
>CROT14TR| codons 14-239
PGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPDNPYNTPVFAIKKKDSTKWRK
LVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIP
SLNNETPGTRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVIYQYMDDLYIGSDL
EIGQHRIKVEELRDHLMKWGFTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12D, I15V, L19I, K20R, E35D, M36I, R41K, I62V, I72E  
>CROT14PT| codons 1-99
PQITLWQRPLVDIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGHKAEGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gaspareto, KV Genetic diversity and primary resistance among HIV-1-positive patients from Maringa, Parana, Brazil. Rev Inst Med Trop Sao Paulo, 2012