<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARG-64 ARG-64 Argentina 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I E35D, N37H, R41K, K43R, L63P, I64V, I93L  
>ARG-64| codons 8-99
RPLVTIKIGGQLKEALLDTGADDTVIEDMHLPGKWRPKMIGGIGGFIKVRQYDQIPVEIC
GHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K82R, K122E, I142V, K166R, K173Q, D177K, I178L, E194EK, I202V, R211K  
>ARG-64| codons 38-232
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRQQNPKLDIYQYMDDLYVGSDLKIGQHRTKVEELRQHLLKWGFTTP
DKKHQKEPPFLWMGY

References
Author Title Citation
Kijak, GH Resistance profiles to antiretroviral drugs in HIV-1 drug-naive patients in Argentina. Antivir Ther, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005