<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHAC_845 PHAC_845 Canada 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   E35D, M36I, R57K, L63P, I64V, I93L  
>PHAC_845| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, V90I, I135V, S162C, Q174QR, T286P, I293V  
>PHAC_845| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKRNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKALTEVVPLTEEAE
LELAENREILKEPV

References
Author Title Citation
Ragonnet-Cronin, M Longitudinal phylogenetic surveillance identifies distinct patterns of cluster dynamics. JAIDS, 2010