<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARG-56 ARG-56 Argentina 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I15V, E35D, M36I, R41K, R57K, Q61D, I62V, L63V, I64L, I72IM  
>ARG-56| codons 4-99
TLWQRPLVIIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDDVV
LEICGHKAMGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, K173Q, I178IM, V179I, T200K, I202V K201Q
>ARG-56| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPDMIIYQYMDDLYVGSDLEIGQHRKQVEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Kijak, GH Resistance profiles to antiretroviral drugs in HIV-1 drug-naive patients in Argentina. Antivir Ther, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005