<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARG-43 ARG-43 Argentina 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I15V, M36I, N37D, R41K, R57K, Q61N, L63A  
>ARG-43| codons 4-99
TLWQRPLVAIKVGGQLKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVKQYDNIA
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135V, I142X, V179I, I202V, V245M  
>ARG-43| codons 132-247
IPSVNNETPGXRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIIYQYMDDLYVGS
DLEIGQHRTKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Kijak, GH Resistance profiles to antiretroviral drugs in HIV-1 drug-naive patients in Argentina. Antivir Ther, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005