<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR18 MNRMP1263 France 1999 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 35
2 3TC+ D4T 39
3 DDI+ D4T+ SQV 56
4 D4T+ NFV+ SQV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V35T, T39D, K49R, V60I, V118I, K122E, I135T, E169D, D177E, G196E, I202V, Q207E, R211K, V245N, D250E, A272P, K277R, T286A, I293V, E297R, G335D, R356K, G359S, T377M, T386I, K390R, A400T, E404D, V435I  
>MNRMP1263| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDELEKEGKISRIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKVEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIAMESIVIWGKIPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, L19T, K20R, E35D, M36I, N37D, I62V, L63P, H69Y, A71T, I72T  
>MNRMP1263| codons 1-99
PQITLWQRPIVTIKIGGQTREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGYKTTSTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005