<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR17 MNR714mal France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ 3TC 28
2 AZT+ IDV+ 3TC 30
3 3TC+ RTV+ SQV 32
4 ABC+ EFV+ NFV 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, L210W, T215Y   L100I, K103N   V35M, K43E, E44D, V118I, K122E, R211K, V245E, A272P, I293V, Q334H, G335S, M357A, G359S, T369V, A371V, I375V, A400T  
>MNR714mal| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHSQWTYQIYQEPFKNLKTGKYARARSA
HTNDVKQLVEVVQKVATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, R41K, L63T, H69Y, A71V, I72T, T74A, V77I, I93L  
>MNR714mal| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFVKVRQYD
QITIEICGYKVTGAVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005