Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MNR14 | MNR4710 | France | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDC | 4 |
| 2 | DDI+ D4T | 19 |
| 3 | AZT+ DDI | 10 |
| 4 | AZT+ DDI+ RTV | 16 |
| 5 | AZT+ DDI+ RTV+ IDV | 25 |
| 6 | DDI+ D4T+ NVP+ RTV | 7 |
| 7 | ABC+ EFV+ SQV+ NFV | 8 |
| 8 | 3TC+ ABC+ NFV+ SQV | 4 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, I84V, L90M | L33F, Q58E, G73S | L10I, T12S, E34Q, E35D, M36L, I62V, L63P |
| >MNR4710| codons 1-99 PQITLWQRPIVSIKIGGQLKEALLDTGADDTVFQDLNLPGRWKPKIIGGIGGFVKVREYD QVPIEICGHKAISTVLVGPTPVNVIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Rousseau, MN | Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. | JAIDS, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |