Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MNR13 | MNR4705 | France | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 10 |
| 2 | AZT+ DDI | 50 |
| 3 | AZT+ 3TC | 40 |
| 4 | AZT+ 3TC+ IDV | 43 |
| 5 | D4T+ RTV+ SQV | 44 |
| 6 | NVP+ SQV+ NFV+ D4T | 5 |
| 7 | D4T+ 3TC+ NFV+ SQV | 2 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, N88S, L90M | L33I, Q58E | L10V, T12P, I13V, K14R, K20T, M36I, I62V, L63P, A71T, I72T, I93L | H69H_NGQCV |
| >MNR4705| codons 1-99 PQITLWQRPVVPVRIGGQLTEALLDTGADDTVIEEINLPGRWKPKIIGGIGGFIKVREYD QVPIEICGHKTTGTVLVGPTPVNIIGRSLMTQLGCTLNF |
References
| Author | Title | Citation |
| Rousseau, MN | Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. | JAIDS, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |