<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR11 MNR4555 France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 2
2 D4T+ DDI 30
3 DDI+ 3TC+ IDV 11
4 DDI+ 3TC+ SQV+ NFV 40
5 D4T+ NVP+ NFV 5
6 D4T+ EFV+ NFV+ SQV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K101P, G190A   V35M, T39K, K43E, V118I, D121H, K122E, K166R, F171Y, Q207E, R211K, A272P, I293V, E297K, I329L, F346G, A360T, K366R, A376T, T386A, I393M, A400T  
>MNR4555| codons 1-408
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICKELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPYRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPGKNLKTGKYARMRGT
HTNDVRQLTEAVQKITTESIVIWGKAPKFKLPMQKETWETWWTEYWQA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S K20I, E35G, M36I, I62V, L63P, A71T  
>MNR4555| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTISTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005