<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR10 MNR4415 France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+ DDI 52
3 3TC+ D4T+ SQV 17
4 3TC+ D4T+ IDV 43
5 D4T+ DDI+ NFV 13
6 D4T+ DDI+ IDV 26
7 D4T+ SQV+ DDI+ RTV 30
8 AZT+ ABC+ SQV+ NFV 2
9 AZT+ DDI+ SQV+ NFV 11
10 Unknown 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M N83D L10I, E35D, M36I, N37D, R41K, R57K, I62V, L63P, I64V, A71V, I93L  
>MNR4415| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFIKVKQYD
QVPVEICGHKVIGTVLVGPTPVDVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       T39A, E44D, V118I, D121Y, K122E, I135T, T200I, H208Y, R211K, K219T, I293V, S322T, R356K, M357T, G359S, A376S, T386I, K390R, A400T, T403V  
>MNR4415| codons 1-439
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQYLWKWGFYTPDTKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKTRSA
HTNDVKQLTEAVQKISTESIVIWGKIPKFRLPIQKETWETWWVEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAET

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005