<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR9 MNR4403 France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 20
2 AZT+ 3TC 27
3 AZT+ DDI+ IDV 55
4 3TC+ AZT+ RTV+ SQV+ NVP 40
5 ABC+ EFV+ NFV 13
6 DDI+ ABC+ EFV+ IDV 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M G73S L10V, I13V, I15V, K20M, E35D, M36I, R41K, K45R, I62V, L63P, I64V  
>MNR4403| codons 1-98
PQITLWQRPVVTVKVGGQLMEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFVKVRQYD
QVPVEICGHKAISTVLVGPTPVNIIGRNLMTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Q151M, M184V, T215F A62V, V75I, F77L, F116Y, K219Q K103N   K20R, V35L, V118I, K122E, I135T, A158S, E169D, D177E, I202V, F214L, D218E, Q278H, E291D, I293V, K311R, M357T, R358K, A376T, K390R, E399D, A400T, E404D  
>MNR4403| codons 1-435
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FVIKKKNSDRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPSIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTDVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFRLPIQKETWDTWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIV

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005