<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR6 MNR4178 France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDI+ D4T+ AZT 52
2 AZT+ DDI+ 3TC 37
3 3TC+ AZT+ DDI+ RTV 3
4 AZT+ DDI+ 3TC+ NFV 4
5 DDI+ D4T+ NVP+ NFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L10F E35D, N37D, L63P, A71T  
>MNR4178| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70E, L210W, T215Y K219N     E44D, V118I, K122E, I135T, G196E, H208Y, R211K, V245M, A272P, I293V, S322T, D324E, P345Q, M357T, T386I, E404D, T419I H198P
>MNR4178| codons 1-422
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQPRTKIEELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKELIAEIQKQGQGQWTYQIYQEQFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNIP
PL

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005