<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MNR4 MNR3994 France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 40
2 RTI 13
3 AZT+ DDI 20
4 AZT+ DDI+ RTV+ SQV 36
5 RTV+ IDV+ AZT+ DDI 5
6 DDI+ D4T+ NFV+ SQV 36
7 3TC+ AZT+ ABC 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M   L10I, I15V, G16A, K20R, E35D, M36I, N37D, R57K, L63P, A71T, Q92R, I93L  
>MNR3994| codons 1-99
PQITLWQRPIVTIKVAGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKTIGTVLVGPTPVNVIGRNLMTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R K103N A98G E44D, V118I, K122E, D123N, I178M, G196E, E203K, E204D, Q207E, H208Y, R211K, K223Q, A272P, L283I, I326V, Q334L, G359S, A371V, K390R, E399D, A400S, T403M, E449D  
>MNR3994| codons 1-449
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYIDDLYVGSDLEIEQHRTKIKDLREYLWKWGFYTPDRKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWDSWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRD

References
Author Title Citation
Rousseau, MN Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005