<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8082 CA20621 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 AZT+DDI+SQV 113
3 3TC+AZT+SQV 39
4 D4T+DDI+EFV 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10LI, I15V, G16E, L63C, T74TA, V77I, I93L  
>CA20621| codons 1-99
PQITLWQRPIVTIKVEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGHKAIGAVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q K103N K238T V60VI, K122E, A158S, I202V, L228H  
>CA20232| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPDQKHQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005