<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHAC09_125 PHAC09_125 Canada 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I13V, K20KQ, M36I, N37G, P39S, R41K, D60E, I62V, I64V  
>PHAC09_125| codons 1-99
PQITLWQRPLVTVKIGGQLQEALLDTGADDTVIEEIGLSGKWKPKMIGGIGGFIKVRQYE
QVLVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35T, D123E, I142IV, D177E, T200TA, R211K, V245E, S251N, L283LI, V292I, I293V, E297Q  
>PHAC09_125| codons 1-314
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDNWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEIVPLTQEAE
LELAENREILKEPV

References
Author Title Citation
Ragonnet-Cronin, M Genetic diversity as a marker for timing infection in HIV-infected patients: Evaluation of a 6-month window and comparison with BED. J Infect Dis, 2012
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012