<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHAC08_302 PHAC08_302 Canada 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36L, R41K, I62V, I64IV, A71T, I72V, V77VI, I93L  
>PHAC08_302| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QVLVEICGHKTVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, G45GE, I135T, I142T, Q174K, T200IM, I202IV, Q207QKR, R211E, V245M, A272T, T286A, V292VI, I293V, T296TS, E297A, K311KR, E312KT  
>PHAC08_302| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEEKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYMDDLYVGSDLEIGQHRMKVEELRRHLLEWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGAKALTEIVPLSAEAE
LELAENREILRTPV

References
Author Title Citation
Ragonnet-Cronin, M Genetic diversity as a marker for timing infection in HIV-infected patients: Evaluation of a 6-month window and comparison with BED. J Infect Dis, 2012
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012