<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4895 CA20580 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 None 105
3 AZT+IDV 38
4 3TC+AZT+IDV 11
5 3TC+AZT+NFV 78
6 3TC+D4T+APV 3
7 3TC+D4T+NFV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E L10V, E35D, P39Q, I62V, L63P, I64V, T74TS, V77VI, I93L  
>CA20580| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDMNLQGRWKPKIIGGIGGFIKVREYD
QVPVEICGHKAIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V       I135IV, F171FY, R211K, V245VM, V292I, I293V  
>CA20190| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005