<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1511 CA20572 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 3TC+AZT+SQV 27
3 3TC+AZT+APV+SQV 11
4 D4T+NFV+NVP 22
5 D4T+NFV+NVP 15
6 Unknown 18
7 3TC+D4T+RTV 19
8 3TC+D4T+IDV+RTV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82T, I84IV, L90M L10LF, K43KT K20M, M36V, L63P, A71V, I93IL, C95CF  
>CA20572| codons 1-99
PQITLWQRPFVTIKIGGQLMEALLDTGADDTVLEEVNLPGRWTPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPTNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     I135M, T200A, K277KR, E291D, E297K  
>CA20186| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTDVIPLTKEAE
L

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005