<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1264 CA20557 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 17
2 3TC+AZT+SQV 70
3 3TC+AZT+NFV 21
4 3TC+D4T+RTV+SQV 15
5 3TC+D4T+RTV+SQV 75
6 3TC+D4T+DDI+EFV+RTV+SQV 17
7 3TC+D4T+DDI+RTV+SQV 18
8 3TC+D4T+RTV+SQV 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V K43T Q7H, L10I, I13V, I15V, K20T, E35D, M36L, N37D, D60E, L63P, I64V, V77I  
>CA20557| codons 1-99
PQITLWHRPIVTVKVGGQLTEALLDTGADDTVLEDLDLPGRWTPKMIVGIGGFVKVRQYE
QIPVEICGHKAIGTVLIGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       V35T, R83K, K122KE, I135V, K166R, Q207E, V245E, A272P, K277R  
>CA20168| codons 1-281
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005