<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8037 CA20556 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+DDC 100
3 D4T 70
4 3TC+D4T+IDV 139
5 3TC+D4T+NFV 119

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M   L10I, N37NS, D60DE, Q61QH, L63Q, I64IV, H69HY, A71V, I72V, V77I, I93L L5LV
>CA20556| codons 1-99
PQITVWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFVKVRQYE
HIQVEICGYKVVGTVLIGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, K219Q     K64H, T69N, T200A, R211K, F214L, D218E, K277R  
>CA20166| codons 1-282
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIHKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005