<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8031 CA20548 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 252
2 DDI 34
3 AZT+3TC 26
4 3TC+AZT+SQV 47
5 D4T+IDV+3TC 52
6 3TC+D4T+SQV 17
7 3TC+D4T+NFV 13
8 D4T+EFV+SQV 30
9 3TC+D4T+DDI 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M F53FL K20KR, E35ED, M36I, R41RK, L63P, A71V, I93L  
>CA20548| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTILEDINLPGKWKPKIIGGIGGLIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   T39K, K43E, V75X, V118VI, I135T, R211K, L228H, K277R, Q278H, T286A, V292I, I293V  
>CA20157| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLXDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGAKALTEIVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005