<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5206 CA20542 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+IDV+NFV 115

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML L10LF, N88NT L63P, I64V, G73X, V77I, I93L  
>CA20542| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIPVEICGHKAIXTVLIGPTPVNIIGRTLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K11KQ, K20KR, K43KE, E44D, K49KR, I135V, G196E, R211A, L228R, I257IV  
>CA20152| codons 1-264
PISPIETVPVQLKPGMDGPRVKQWPLTEEKIKALVEICTELEEDGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWAWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDVQKLVGKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005