<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8026 CA20539 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 171

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, K20I, E35D, M36I, N37S, R41K, D60E, I62V, L63P, I64V, A71V, I93L  
>CA20539| codons 1-99
PQITLWQRPVVTIKIGGQLIEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYE
QVPVEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219EQ     K43KQ, K46KQ, I135M, S162Y, E169D, T200A, Q207K, R211Q, V245E, A272P, R284K  
>CA20149| codons 1-284
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGQISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLQWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005